Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline
    Tel: +86-28-62328193

  • Ms.Lory
    外贸员
    Tel: +86-18108172074

  • Ms.Cecilia
    外贸员
    Tel: +86-18108235634

  • Ms.Sylvia
    外贸员
    Tel: +86-17711399154

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:+86-28-62328193
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  Custom peptide Foxox4 / foxo4 dri / Senolytics

Custom peptide Foxox4 / foxo4 dri / Senolytics

  • FOB Price: USD: 1.00-1.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,T/T,Other
  • Available Specifications:

    Cosmetic(1-100)Gram

  • Product Details

Keywords

  • Senolytics
  • Foxox4
  • Foxox4 DRI

Quick Details

  • ProName: Custom peptide Foxox4 / foxo4 dri / Se...
  • Molecular Formula: N/A
  • Appearance: white powder
  • Application: Active Pharmaceutical Intermediate
  • DeliveryTime: 2~5 working days
  • PackAge: glass/plastic bottle protected by bubb...
  • Port: Chengdu
  • ProductionCapacity: 500 Gram/Week
  • Purity: 98%
  • Storage: 2~8 ℃
  • Transportation: FedEx/DHL/EMS or by air.
  • LimitNum: 1 Gram
  • Moisture Content: 0
  • Impurity: 0
  • Appearance: blue powder
  • Samples: available
  • Grade: cosmetic
  • MSDS/COA: available
  • Shelf life: 24 months
  • Source: synthesis
  • Stability: stable
  • Delivery: promptly from stock

Superiority

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.

Details

Product Description:


 

2017 hot sale FOX 04DRI / Senolytics

 

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

 

 

FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

 

Shipping:


FedEx/DHL/EMS or by air.

 

Packaging:


glass/plastic bottle protected by bubble film

Our Services:


More details or free sample, feel free to contact Sylvia:-)

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog