High pure Sermorelin Acetate powder with fast delivery from China CAS NO.114466-38-5

FOB Price: USD: 1.00-1.00 /Gram Get Latest Price
Min.Order: 1 Gram
Payment Terms: L/C,T/T,
Available Specifications:
high quality(1-10)Gram1/Gram1USD

Product Details

Keywords

Sermorelin Acetate
114466-38-5
Sermorelin

Quick Details

ProName: High pure Sermorelin Acetate powder wi...
CasNo: 114466-38-5
Molecular Formula: C151H250N44O44S
Appearance: white powder
Application: Phamaceutical Grade
DeliveryTime: 3-5 working days after payment
PackAge: 1 gram per bottle(plastic bottle or gl...
Port: Chengdu
ProductionCapacity: 1000 Gram/Month
Purity: 98%
Storage: 2-8 degree
Transportation: Normal temperature
LimitNum: 1 Gram
Moisture Content: N/A
Impurity: N/A
cas: Sermorelin Acetate
shelf life: 2 years
brand: youngshe
color: white
Grade:: Phamaceutical Grade

Superiority

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.Youngshe Chem provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredients and related

Details

Sermorelin Acetate

name: Sermorelin Acetate

Cas No: 86168-78-7(net),114466-38-5(acetate)

Formula: C151H250N44O44S

Molecular:3417

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].