medical peptide Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S GHRH Sermorelina, Sermorelinum CAS NO.114466-38-5
- FOB Price: USD: 10.00-10.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
top(1-10)Gram
- Product Details
Keywords
- Sermorelin
- GHRH(1-29)
- Sermorelina
Quick Details
- ProName: medical peptide Sermorelin Acetate Cas...
- CasNo: 114466-38-5
- Molecular Formula: C151H250N44O44S
- Appearance: white powder
- Application: medical
- DeliveryTime: 3-5 WORK DAYS
- PackAge: plastic/glass bottle, aluminium foil b...
- Port: chengdu
- ProductionCapacity: 10000 Gram/Week
- Purity: 98% min
- Storage: sealed, keep it in refrigerator at 2-8...
- LimitNum: 1 Gram
Superiority
Chengdu YoungShe
Chemical Co.,Ltd
Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.
YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.
Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
We have a professional factory, independent research and
development technology, high efficiency technology
Details
1.Basic information:
Na Name: Sermorelin Acetate 11.14 L11.16
Cas No: 86168-78-7(net),114466-38-5(acetate)
Formula: C151H250N44O44S
Molecular:3417
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].
2.Description: