Hot sale Antiibacterial peptide LL-37 human in stock CAS NO.154947-66-7
- FOB Price: USD: 500.00-500.00 /Gram Get Latest Price
- Min.Order: 100 Milligram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
TOP grade (1-10)Gram
- Product Details
Keywords
- LL-37
- LL37
- LL-37 human
Quick Details
- ProName: Hot sale Antiibacterial peptide LL-37 ...
- CasNo: 154947-66-7
- Molecular Formula: C205H340N60O53
- Appearance: White powder
- Application: Skin care peptide as cosmetic ingredie...
- DeliveryTime: three to five days
- PackAge: plastic bottle
- Port: Chengdu
- ProductionCapacity: 200 Gram/Month
- Purity: 98% min
- Storage: Store at 2-8 degrees
- Transportation: DHL, FeDex and EMS
- LimitNum: 100 Milligram
- In stock: Yes
- coa and msds: available for your references
Superiority
Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related. |
---|
Details
INCI Name |
LL - 37, Antimicrobial Peptide, human |
Purity |
95-99% |
MSDS and COA |
available for your reference |
Delivery |
promptly from stock |
Molecular Formula |
|
Cas |
154947-66-7 |
LL-37, Antimicrobial Peptide, human
Basic information: Name: LL - 37, Antimicrobial Peptide, human Sequence: [LL-37, 37 aa]
Cas No: MF: MW: Purity: >95%
Source: synthetic Grade: cosmetic
Additive:
Grade: cosmetic
Formulation: available for your reference,
please contact us. MSDS and COA: available for your reference, please contact us Delivery: promptly from stock Odor: characteristic Stability: stable Solubility: soluble in water Appearance: white powder Capacity: 600g per month Usage: Antimicrobial
Packaging & Shipping
Professional packaging, the best quality and service
Company Profile
Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
Our Advantages
1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.
2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.
3. Professionalism of service: customer satisfaction is our greatest work.
4. Reliability: We always believe that only good reputation and product quality can make a good company.
5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.
6. Variety products: We offer more than 200 peptides, including dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, copper peptide, oligopeptide and so on.
FAQ
Q1: Are you a manufacturer Answer: Yes, we are factory founded on 2015. |
||||
Q2: How to contact with us |
||||
Q3:Which kind of payment terms do you accept |
||||
Q4:Can you give me a discount price Surely,It depend on your qty |
||||
Q5:How do you treat quality complaint A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss. |