Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline
    Tel: +86-28-62328193

  • Ms.Lory
    外贸员
    Tel: +86-18108172074

  • Ms.Cecilia
    外贸员
    Tel: +86-18108235634

  • Ms.Sylvia
    外贸员
    Tel: +86-17711399154

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:+86-28-62328193
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  Hot sale Antiibacterial peptide LL-37 human in stock

Hot sale Antiibacterial peptide LL-37 human in stock CAS NO.154947-66-7

  • FOB Price: USD: 500.00-500.00 /Gram Get Latest Price
  • Min.Order: 100 Milligram
  • Payment Terms: L/C,T/T,Other
  • Available Specifications:

    TOP grade (1-10)Gram

  • Product Details

Keywords

  • LL-37
  • LL37
  • LL-37 human

Quick Details

  • ProName: Hot sale Antiibacterial peptide LL-37 ...
  • CasNo: 154947-66-7
  • Molecular Formula: C205H340N60O53
  • Appearance: White powder
  • Application: Skin care peptide as cosmetic ingredie...
  • DeliveryTime: three to five days
  • PackAge: plastic bottle
  • Port: Chengdu
  • ProductionCapacity: 200 Gram/Month
  • Purity: 98% min
  • Storage: Store at 2-8 degrees
  • Transportation: DHL, FeDex and EMS
  • LimitNum: 100 Milligram
  • In stock: Yes
  • coa and msds: available for your references

Superiority

1, High quality with competitive price:
2, Fast and safe delivery
3.Excellent pre-sales and after-sales service
4. Well-trained and professional technologist and sales with rich experience in the field for 5-10 years
 

 

Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

Details

INCI Name

LL - 37, Antimicrobial Peptide, human

Purity

95-99%

MSDS and COA

available for your reference

Delivery

promptly from stock

Molecular Formula

 

Cas


154947-66-7

LL-37, Antimicrobial Peptide, human

Basic information: Name: LL - 37, Antimicrobial Peptide, human Sequence: [LL-37, 37 aa]

Cas No: MF: MW: Purity: >95%

Source: synthetic Grade: cosmetic

Additive:

Grade: cosmetic

Formulation: available for your reference,

please contact us. MSDS and COA: available for your reference, please contact us Delivery: promptly from stock Odor: characteristic Stability: stable Solubility: soluble in water Appearance: white powder Capacity: 600g per month Usage: Antimicrobial

Youngshe High Purity Peptide Astressin-B Powder for Hair Growth

 

Packaging & Shipping

Youngshe High Purity Peptide Astressin-B Powder for Hair Growth            Professional packaging, the best quality and service

Company Profile

Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
Youngshe High Purity Peptide Astressin-B Powder for Hair Growth

Our Advantages

1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.
2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.
3. Professionalism of service: customer satisfaction is our greatest work.
4. Reliability: We always believe that only good reputation and product quality can make a good company.
5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.
6. Variety products: We offer more than 200 peptides, including dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, copper peptide, oligopeptide and so on.
Youngshe High Purity Peptide Astressin-B Powder for Hair GrowthYoungshe High Purity Peptide Astressin-B Powder for Hair Growth

FAQ

 

Q1: Are you a manufacturer

Answer: Yes, we are factory founded on 2015.

Q2: How to contact with us  
Click the Alibaba "Contact Supplier" And then send us message the product you interest in, you will get reply within 24 hours. Or email Caroline

Q3:Which kind of payment terms do you accept
For small order,you can pay by T/T,, nomal order by T/T to our company account

Q4:Can you give me a discount price

Surely,It depend on your qty

Q5:How do you treat quality complaint

A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.

 

 

 

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog