China (Mainland)
Synthetic Peptide Cas16941-32-5 GLP-1(7-37) CAS NO.16941-32-5
- FOB Price: USD: 1.00-1.00 /Milligram Get Latest Price
- Min.Order: 1 Milligram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
Medicine grade (1-10)Milligram
- Product Details
Keywords
- GLP-1(7-37)
- Tglp-1
- 16941-32-5
Quick Details
- ProName: Synthetic Peptide Cas16941-32-5 GLP-1(...
- CasNo: 16941-32-5
- Molecular Formula: C65H96N16O12S2
- Appearance: White powder
- Application: Active pharmaceutical intermediate
- DeliveryTime: three to five days
- PackAge: plastic bottle
- Port: Chengdu
- ProductionCapacity: 20 Kilogram/Month
- Purity: 98% min
- Storage: Store at 2-8 degrees
- Transportation: DHL, FedEx and EMS
- LimitNum: 1 Milligram
- In stock: Yes
- coa and msds: available for your references
Superiority
High purity
Fast delivery
In stock always
We promise full refund if any quality problems
Details
Name:GLP-1(7-37), Insulinotropin
Cas No:16941-32-5, 106612-94-6 (net)
Formula: C151H228N40O47
Molecular: 3355.66
Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related peptide (Oncorhynchus kisutch)