Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Cecilia
    外贸员
    Tel: +86-18108235634

  • Mobile:+86-18108235634
  • Tel:+86-18108235634
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  High pure Sermorelin Acetate powder with fast delivery from China

High pure Sermorelin Acetate powder with fast delivery from China CAS NO.114466-38-5

  • FOB Price: USD: 1.00-1.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,T/T,
  • Available Specifications:

    high quality(1-10)Gram

  • Product Details

Keywords

  • Sermorelin Acetate
  • 114466-38-5
  • Sermorelin

Quick Details

  • ProName: High pure Sermorelin Acetate powder wi...
  • CasNo: 114466-38-5
  • Molecular Formula: C151H250N44O44S
  • Appearance: white powder
  • Application: Phamaceutical Grade
  • DeliveryTime: 3-5 working days after payment
  • PackAge: 1 gram per bottle(plastic bottle or gl...
  • Port: Chengdu
  • ProductionCapacity: 1000 Gram/Month
  • Purity: 98%
  • Storage: 2-8 degree
  • Transportation: Normal temperature
  • LimitNum: 1 Gram
  • Moisture Content: N/A
  • Impurity: N/A
  • cas: Sermorelin Acetate
  • shelf life: 2 years
  • brand: youngshe
  • color: white
  • Grade:: Phamaceutical Grade

Superiority

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.Youngshe Chem provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredients and related

Details

Sermorelin Acetate

 

 

 

name: Sermorelin Acetate

Cas No: 86168-78-7(net),114466-38-5(acetate)

Formula: C151H250N44O44S

Molecular:3417

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

 

 

 

 

 

Other hot sale peptides:

 

Anti-aging skincare peptide Acetyl Hexapeptide-3 Argireline Cas: 616204-22-9

 

SYN-AKE Cas:823202-99-9

 

Anti-wrinkle peptide powder Acetyl Octapeptide-3 SNAP-8 Cas 868844-74-0

 

Skin whitening peptide Decapeptide-12 Lumixyl

 

Anti hair loss ingredient Procapil Biotinoyl Tripeptide-1 Biotin-GHK

 

Eyelash growth peptide Myristoyl Pentapeptide-17

 

Matrixyl 3000 powder CAS: 77727-17-4

 

Collagen hexapeptide Collaxyl Hexapeptide-9

 

Acetyl Hexapeptide-38/Adifyline for breast enlargement

 

Semax and N-Acetyl Semax/CAS:4037-01-8 80714-61-0

 

TB-500(Thymosin beta-4)

 

Bremelanotide CAS 32780-32-8 PT141

 

Liraglutide DMF preparation CAS : 204656-20-2

 

FOXO4-D-Retro-Inverso(DRI) Custom peptide Senolytics Peptide

 

 

 

Order process

1. Send us your request

2.Confirm price,delivery time,payment term,your request and all details you care

3.Sign contract and issue invoice

4.Payment by your side

5.We arrange shipment immediately after confirm payment

6.Delivery( door to door,around 5 working days)

7.Follow-up service

 

 

Company Information

Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.

 

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.

 

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

 

Payment

Paypal,,Money Gram,L/C,T/T are all acceptable.

 

Pls contact Cecilia for more details.

 

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog