China (Mainland)
Synthetic Peptide Cas119637-73-9 IRP peptide CAS NO.119637-73-9
- FOB Price: USD: 1.00-1.00 /Milligram Get Latest Price
- Min.Order: 1 Milligram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
Medicine grade (1-10)Milligram
- Product Details
Keywords
- IRP peptide
- Glp-1a
- 119637-73-9
Quick Details
- ProName: Synthetic Peptide Cas119637-73-9 IRP p...
- CasNo: 119637-73-9
- Molecular Formula: C149H226N40O45
- Appearance: White powder
- Application: Active pharmaceutical intermediate
- DeliveryTime: three to five days
- PackAge: plastic bottle
- Port: Chengdu
- ProductionCapacity: 20 Kilogram/Month
- Purity: 98% min
- Storage: Store at 2-8 degrees
- Transportation: DHL, FedEx and EMS
- LimitNum: 1 Milligram
- In stock: Yes
- coa and msds: available for your references
Superiority
High purity
Fast delivery
In stock always
We promise full refund if any quality problems
Details
Name:GLP-1(7-36), IRP peptide
Cas No: 119637-73-9, 107444-51-9
Formula: C149H226N40O45
Molecular: 3297
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Glp-1a, Glp-I (7-36)amide, Glp-1 (7-36)amide, Glp-I (7-36)NH2, Glucagon-like peptide I (7-36)amide