Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:86-17380623303
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  Synthetic Peptide Cas119637-73-9 IRP peptide

Synthetic Peptide Cas119637-73-9 IRP peptide CAS NO.119637-73-9

  • FOB Price: USD: 1.00-1.00 /Milligram Get Latest Price
  • Min.Order: 1 Milligram
  • Payment Terms: L/C,T/T,Other
  • Available Specifications:

    Medicine grade (1-10)Milligram

  • Product Details

Keywords

  • IRP peptide
  • Glp-1a
  • 119637-73-9

Quick Details

  • ProName: Synthetic Peptide Cas119637-73-9 IRP p...
  • CasNo: 119637-73-9
  • Molecular Formula: C149H226N40O45
  • Appearance: White powder
  • Application: Active pharmaceutical intermediate
  • DeliveryTime: three to five days
  • PackAge: plastic bottle
  • Port: Chengdu
  • ProductionCapacity: 20 Kilogram/Month
  • Purity: 98% min
  • Storage: Store at 2-8 degrees
  • Transportation: DHL, FedEx and EMS
  • LimitNum: 1 Milligram
  • In stock: Yes
  • coa and msds: available for your references

Superiority

High purity

Fast delivery

In stock always 

We promise full refund if any quality problems 

Details

Name:GLP-1(7-36), IRP peptide

Cas No: 119637-73-9, 107444-51-9

Formula: C149H226N40O45

Molecular: 3297

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Glp-1a, Glp-I (7-36)amide, Glp-1 (7-36)amide, Glp-I (7-36)NH2, Glucagon-like peptide I (7-36)amide

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog