Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:86-17380623303
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  Pharmaceutical raw material Enfuvirtide

Pharmaceutical raw material Enfuvirtide CAS NO.159519-65-0

  • FOB Price: USD: 1.00-1.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,T/T,Other
  • Available Specifications:

    Cosmetic(1-100)Gram

  • Product Details

Keywords

  • Enfuvirtide Acetate
  • peptide intermediate
  • 159519-65-0

Quick Details

  • ProName: Pharmaceutical raw material Enfuvirtid...
  • CasNo: 159519-65-0
  • Molecular Formula: C204H301N51O64
  • Appearance: white powder
  • Application: Active Pharmaceutical Intermediate
  • DeliveryTime: 2~5 working days
  • PackAge: glass/plastic bottle protected by bubb...
  • Port: Chengdu
  • ProductionCapacity: 500 Gram/Week
  • Purity: 98%
  • Storage: 2~8 ℃
  • Transportation: FedEx/DHL/EMS or by air.
  • LimitNum: 1 Gram
  • Moisture Content: 0
  • Impurity: 0
  • Appearance: blue powder
  • Samples: available
  • Grade: cosmetic
  • MSDS/COA: available
  • Shelf life: 24 months
  • Source: synthesis
  • Stability: stable
  • Delivery: promptly from stock

Superiority

Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.

Details

Product Description:


 

 Enfuvirtide Acetate

Cas No: 159519-65-0

Formular: C204H301N51O64

Molecular:4491.87

Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178

 

 

Shipping:


FedEx/DHL/EMS or by air.

 

Packaging:


glass/plastic bottle protected by bubble film

Our Services:


More details or free sample, feel free to contact Sylvia:-)

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog