youngshe professional peptide medical Enfuvirtide Acetate Cas No: 159519-65-0 Formular: C204H301N51O64 Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178 CAS NO.159519-65-0

FOB Price: USD: 10.00-10.00 /Gram Get Latest Price
Min.Order: 1 Gram
Payment Terms: L/C,T/T,Other
Available Specifications:
top(1-10)Gram10/Gram1USD

Product Details

Keywords

Enfuvirtide Acetate
Pentafuside
Fuzeon

Quick Details

ProName: youngshe professional peptide medical ...
CasNo: 159519-65-0
Molecular Formula: C204H301N51O64
Appearance: white powder
Application: medical
DeliveryTime: 3-5 WORK DAYS
PackAge: plastic/glass bottle, aluminium foil b...
Port: chengdu
ProductionCapacity: 10000 Gram/Week
Purity: 98% min
Storage: sealed, keep it in refrigerator at 2-8...
LimitNum: 1 Gram

Superiority

Chengdu YoungShe

Chemical Co.,Ltd

Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

We have a professional factory, independent research and

development technology, high efficiency technology

Details

1.Basic information:

Na Name:Enfuvirtide Acetate

Cas No: 159519-65-0

Formular: C204H301N51O64

Molecular:4491.87

Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178

2.Description: