Pharmaceutical raw material GLP-1 (7-37) CAS NO.16941-32-5
- FOB Price: USD: 1.00-1.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
Cosmetic(1-100)Gram
- Product Details
Keywords
- GLP 1
- Insulinotropin
- 16941-32-5
Quick Details
- ProName: Pharmaceutical raw material GLP-1 (7-3...
- CasNo: 16941-32-5
- Molecular Formula: C151H228N40O47
- Appearance: white powder
- Application: Active Pharmaceutical Intermediate
- DeliveryTime: 2~5 working days
- PackAge: glass/plastic bottle protected by bubb...
- Port: Chengdu
- ProductionCapacity: 500 Gram/Week
- Purity: 98%
- Storage: 2~8 ℃
- Transportation: FedEx/DHL/EMS or by air.
- LimitNum: 1 Gram
- Moisture Content: 0
- Impurity: 0
- Appearance: blue powder
- Samples: available
- Grade: cosmetic
- MSDS/COA: available
- Shelf life: 24 months
- Source: synthesis
- Stability: stable
- Delivery: promptly from stock
Superiority
Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. You can select more than 170 kinds of raw cosmetic peptide ingredients here.And we are keeping developing new products and continuously marketing them for sale.
Details
Product Description:
GLP-1(7-37), Insulinotropin
Cas No:16941-32-5, 106612-94-6 (net)
Formula: C151H228N40O47
Molecular: 3355.66
Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related peptide (Oncorhynchus kisutch),
Shipping:
FedEx/DHL/EMS or by air.
Packaging:
glass/plastic bottle protected by bubble film
Our Services:
More details or free sample, feel free to contact Sylvia:-)