Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline
    Tel: +86-28-62328193

  • Ms.Lory
    外贸员
    Tel: +86-18108172074

  • Ms.Cecilia
    外贸员
    Tel: +86-18108235634

  • Ms.Sylvia
    外贸员
    Tel: +86-17711399154

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:+86-28-62328193
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  Synthetic Peptide Cas16941-32-5 GLP-1(7-37)

Synthetic Peptide Cas16941-32-5 GLP-1(7-37) CAS NO.16941-32-5

  • FOB Price: USD: 1.00-1.00 /Milligram Get Latest Price
  • Min.Order: 1 Milligram
  • Payment Terms: L/C,T/T,Other
  • Available Specifications:

    Medicine grade (1-10)Milligram

  • Product Details

Keywords

  • GLP-1(7-37)
  • Tglp-1
  • 16941-32-5

Quick Details

  • ProName: Synthetic Peptide Cas16941-32-5 GLP-1(...
  • CasNo: 16941-32-5
  • Molecular Formula: C65H96N16O12S2
  • Appearance: White powder
  • Application: Active pharmaceutical intermediate
  • DeliveryTime: three to five days
  • PackAge: plastic bottle
  • Port: Chengdu
  • ProductionCapacity: 20 Kilogram/Month
  • Purity: 98% min
  • Storage: Store at 2-8 degrees
  • Transportation: DHL, FedEx and EMS
  • LimitNum: 1 Milligram
  • In stock: Yes
  • coa and msds: available for your references

Superiority

High purity

Fast delivery

In stock always 

We promise full refund if any quality problems 

Details

Name:GLP-1(7-37), Insulinotropin

Cas No:16941-32-5, 106612-94-6 (net)

Formula: C151H228N40O47

Molecular: 3355.66

Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related peptide (Oncorhynchus kisutch)

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog