- Product Details
Keywords
- (Ala11?22?2?)-VIP
- (Ala11?22?2?)-Aviptadil
- HSDAVFTDNYARLRKQMAVKKALNSILA-NH?
Quick Details
- ProName: (Ala11?22?2?)-VIP
- CasNo: 291524-04-4
- Molecular Formula: C???H???N??O??S
- Appearance: white powder
- Application: cosmetic or pharmaceutical
- DeliveryTime: 4-5 days
- PackAge: According to client's requirements
- Port: Chengdu,China
- Purity: 95%
- Storage: keep sealed and keep from direct light
- Transportation: According to client's requirements
- LimitNum: 0
- Related Substances: send with COA
- Residue on Ignition: send with COA
- Heavy Metal: 0
- Valid Period: 2 years
Superiority
peptide expert with good price, fast delivery and high quality