Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:86-17380623303
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  VIP

VIP CAS NO.40077-57-4

  • Min.Order: 0
  • Payment Terms:
  • Product Details

Keywords

  • VIP
  • Aviptadil, VIP, human, porcine, rat, ovine
  • HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH?

Quick Details

  • ProName: VIP
  • CasNo: 40077-57-4
  • Molecular Formula: C???H???N??O??S
  • Appearance: white powder
  • Application: cosmetic or pharmaceutical
  • DeliveryTime: 4-5 days
  • PackAge: According to client's requirements
  • Port: Chengdu,China
  • Purity: 95%
  • Storage: keep sealed and keep from direct light
  • Transportation: According to client's requirements
  • LimitNum: 0
  • Related Substances: send with COA
  • Residue on Ignition: send with COA
  • Heavy Metal: 0
  • Valid Period: 2 years

Superiority

peptide expert with good price, fast delivery and high quality

Details

cosmetic peptide, API, catalog peptide, custom peptide synthesis

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog