Sermorelin Acetate CAS NO.86168-78-7
- FOB Price: USD: 200.00-200.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
high quality(1-10)Gram
- Product Details
Keywords
- Sermorelin
- Sermorelin Acetate
- 86168-78-7
Quick Details
- ProName: Sermorelin Acetate
- CasNo: 86168-78-7
- Molecular Formula: C151H250N44O44S
- Appearance: White powder
- Application: Active pharmaceutical intermediate
- DeliveryTime: three to five days
- PackAge: Customized packing
- Port: Chengdu
- ProductionCapacity: 0.5 Kilogram/Month
- Purity: 98% min
- Storage: Store at 2-8 degrees
- Transportation: DHL, FeDex and EMS
- LimitNum: 1 Gram
- In stock: Yes
- coa and msds: available for your references
Superiority
1, High quality with competitive price: 2, Fast and safe delivery 3.Excellent pre-sales and after-sales service 4. Well-trained and professional technologist and sales with rich experience in the field for 5-10 years |
---|
Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
Details
Sermorelin Acetate
Name | Sermorelin Acetate |
Cas No | 86168-78-7(net) ,114466-38-5(acetate) |
Formula | C151H250N44O44S |
Molecular | 3417 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQ |
Purity | 98% |
Appearance | white powder |
Source | synthetic |
Guarantee: Full refund if you met any quality problem
Medicine peptide and custom peptide are available! Welcom to contact us!
Custom peptide pls contact us!
Packaging & Shipping
Professional packaging, the best quality and service
Company Profile
Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale. YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. Since Dec,2015, YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
Our Advantages
1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.
2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.
3. Professionalism of service: customer satisfaction is our greatest work.
4. Reliability: We always believe that only good reputation and product quality can make a good company.
5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.
6. Variety products: We offer more than 200 peptides, including dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, copper peptide, oligopeptide and so on.
FAQ
Q1: Are you a manufacturer Answer: Yes, we are factory founded on 2015. |
||||
Q2: How to contact with us |
||||
Q3:Which kind of payment terms do you accept |
||||
Q4:Can you give me a discount price Surely,It depend on your qty |
||||
Q5:How do you treat quality complaint A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss. |