medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2 CAS NO.86784-80-7
- FOB Price: USD: 10.00-10.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
top(1-10)Gram
- Product Details
Keywords
- CRF
- ,Corticotropin releasing factor
- Corticoliberin, Corticorelin
Quick Details
- ProName: medical peptide API CRF(human,rat) Cor...
- CasNo: 86784-80-7
- Molecular Formula: C208H344N60O63S2
- Appearance: white powder
- Application: medical
- DeliveryTime: 3-5 WORK DAYS
- PackAge: plastic/glass bottle, aluminium foil b...
- Port: chengdu
- ProductionCapacity: 10000 Gram/Week
- Purity: 98% min
- Storage: sealed, keep it in refrigerator at 2-8...
- LimitNum: 1 Gram
Superiority
Chengdu YoungShe
Chemical Co.,Ltd
Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.
YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.
Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
We have a professional factory, independent research and
development technology, high efficiency technology
Details
1.Basic information:
Na ame: CRF(human,rat),Corticotropin releasing factor
Cas No: 86784-80-7
Formula: C208H344N60O63S2
Molecular: 4757.45
Sequence:H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH?
Purity:98%
Appearance: white powder
Source: synthetic
Also know as: Corticoliberin, Corticorelin, CRF-41, CRH
CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.
2.Description: