Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:86-17380623303
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2

medical peptide API CRF(human,rat) Corticotropin releasing factor Cas No: 86784-80-7 Formula: C208H344N60O63S2 CAS NO.86784-80-7

  • FOB Price: USD: 10.00-10.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,T/T,Other
  • Available Specifications:

    top(1-10)Gram

  • Product Details

Keywords

  • CRF
  • ,Corticotropin releasing factor
  • Corticoliberin, Corticorelin

Quick Details

  • ProName: medical peptide API CRF(human,rat) Cor...
  • CasNo: 86784-80-7
  • Molecular Formula: C208H344N60O63S2
  • Appearance: white powder
  • Application: medical
  • DeliveryTime: 3-5 WORK DAYS
  • PackAge: plastic/glass bottle, aluminium foil b...
  • Port: chengdu
  • ProductionCapacity: 10000 Gram/Week
  • Purity: 98% min
  • Storage: sealed, keep it in refrigerator at 2-8...
  • LimitNum: 1 Gram

Superiority

Company Information

 

Chengdu YoungShe

 

Chemical Co.,Ltd

Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to  the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.


 

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. 

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

 

We have a professional factory, independent research and 

 

development technology, high efficiency technology

 

 

 

Details

1.Basic information:

Na   ame: CRF(human,rat),Corticotropin releasing factor  

Cas No: 86784-80-7

Formula: C208H344N60O63S2

Molecular: 4757.45

Sequence:H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH?

Purity:98%

Appearance: white powder

Source: synthetic

Also know as: Corticoliberin, Corticorelin, CRF-41, CRH

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

2.Description:

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog