Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Caroline
    Tel: +86-28-62328193

  • Ms.Lory
    外贸员
    Tel: +86-18108172074

  • Ms.Cecilia
    外贸员
    Tel: +86-18108235634

  • Ms.Sylvia
    外贸员
    Tel: +86-17711399154

  • Ms.Caroline1
    Tel: 86-17380623303

  • Mobile:86-17380623303
  • Tel:+86-28-62328193
  • Fax:+86-28-62328193
  • URL:http://www.youngshechem.com
  • Province/state:sichuan
  • City:chengdu
  • Street:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China
  • MaxCard:
Home > Products >  youngshe professional peptide medical API ACTH(1-39), Corticotropin Cas No: 9002-60-2 Formula: C207H308N56O58S Adrenocorticotropin, ACTH, Corticotrophine

youngshe professional peptide medical API ACTH(1-39), Corticotropin Cas No: 9002-60-2 Formula: C207H308N56O58S Adrenocorticotropin, ACTH, Corticotrophine CAS NO.9002-60-2

  • FOB Price: USD: 10.00-10.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,T/T,Other
  • Available Specifications:

    top(1-10)Gram

  • Product Details

Keywords

  • ACTH(1-39)
  • Corticotropin
  • Adrenocorticotropin

Quick Details

  • ProName: youngshe professional peptide medical ...
  • CasNo: 9002-60-2
  • Molecular Formula: C207H308N56O58S
  • Appearance: white powder
  • Application: medical
  • DeliveryTime: 3-5 WORK DAYS
  • PackAge: plastic/glass bottle, aluminium foil b...
  • Port: chengdu
  • ProductionCapacity: 10000 Gram/Week
  • Purity: 98% min
  • Storage: sealed, keep it in refrigerator at 2-8...
  • LimitNum: 1 Gram

Superiority

Company Information

 

Chengdu YoungShe

 

Chemical Co.,Ltd

Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to  the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.


 

YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. 

Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

 

We have a professional factory, independent research and 

 

development technology, high efficiency technology

 

 

 

Details

1.Basic information:

Na  Name: ACTH(1-39), Corticotropin  

 

Cas No: 9002-60-2

Formula: C207H308N56O58S

Molecular: 4541.0658

Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum

 

2.Description:

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog