youngshe professional peptide medical API Teriparatide Acetate, Teriparatida , TeriparatidumFertirelin Acetate Cas No: 52232-67-4(net),99294-94-7(acetate) Formula: C181H291N55O51S2 Forteo,hPTH CAS NO.99294-94-7
- FOB Price: USD: 10.00-10.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,T/T,Other
- Available Specifications:
top(1-10)Gram
- Product Details
Keywords
- Teriparatide
- Teriparatida
- Teriparatidum
Quick Details
- ProName: youngshe professional peptide medical ...
- CasNo: 99294-94-7
- Molecular Formula: C181H291N55O51S2
- Appearance: white powder
- Application: medical
- DeliveryTime: 3-5 WORK DAYS
- PackAge: plastic/glass bottle, aluminium foil b...
- Port: chengdu
- ProductionCapacity: 10000 Gram/Week
- Purity: 98% min
- Storage: sealed, keep it in refrigerator at 2-8...
- LimitNum: 1 Gram
Superiority
Chengdu YoungShe
Chemical Co.,Ltd
Chengdu YoungShe Chemical Co Ltd is good cosmetic peptide supplier in China.We are dedicating to the professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.
YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.
Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
We have a professional factory, independent research and
development technology, high efficiency technology
Details
1.Basic information:
Na Name:Teriparatide Acetate, Teriparatida , Teriparatidum
Cas No: 52232-67-4(net),99294-94-7(acetate)
Formula: C181H291N55O51S2
Molecular: 4117.71
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity:98%
Appearance: white powder
Source: synthetic
Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide
Parathar,Teriparatide Acetate,Teriparatide Aventis Brand
2.Description: